1. Notes: 7335 / 1 day ago  from zombiephd (originally from thefrogman)
  2. Notes: 217473 / 1 day ago  from zombiephd (originally from mockingday)

    (Source: mockingday)

  3. Notes: 49194 / 1 day ago  from doctorwho (originally from themostimpassionedsong)

    New Who Doctors in their previous incarnation’s clothes

    (Source: themostimpassionedsong)

  4. Notes: 471670 / 2 days ago  from tyleroakley (originally from merakiandmelaninblooms)

    artemia:

    note-a-bear:

    aminaabramovic:

    everyone needs to watch this video before they log off tonight

    well, now I know what I’m doing every time a car alarm goes off

    this looks like so much fun

    (Source: merakiandmelaninblooms)

  5. Notes: 45352 / 2 days ago  from joshiejoshh (originally from thecutestofthecute)

    embraceyourfreak said: Do you have any pictures of dogs running so fast they look like they're hover-crafts? Love your blog by the way, totally brightens my day!

    doublepistolsandawonk:

    thecutestofthecute:

    ACTIVATING LAUNCH SEQUENCE IN 3.. 2..1

    image

    image

    image

    image

    image

    image

    jesus lord

  6. Notes: 863375 / 3 days ago  from zombiephd (originally from 4gifs)
    zombiephd:

cake-full-of-fist:

captain-raptor:

bookishbutcorruptible:

tacoderps:

mamakarkat:

i think this person is a wizard

when you don’t compete in the olympics because you want it to be fair

I don’t think Aang is the last airbender.

i’m in love with how the “flip at your own risk” sign pans in dramatically and he does fifty flips in midair right in front of it and sticks the landing pose like “go fuck yourself i do what i want”

all the awards for that comment

rainalmighty
championfaust he is a wizard

    zombiephd:

    cake-full-of-fist:

    captain-raptor:

    bookishbutcorruptible:

    tacoderps:

    mamakarkat:

    i think this person is a wizard

    when you don’t compete in the olympics because you want it to be fair

    I don’t think Aang is the last airbender.

    i’m in love with how the “flip at your own risk” sign pans in dramatically and he does fifty flips in midair right in front of it and sticks the landing pose like “go fuck yourself i do what i want”

    all the awards for that comment

    rainalmighty

    championfaust he is a wizard

    (Source: 4gifs)

     
  7. Notes: 367 / 3 days ago  from wewereborntudie
    Is it Christmas yet?

    Is it Christmas yet?

     
  8. Notes: 1890 / 3 days ago  from doctorwho

    sickles-and-snitches said: who runs this account?

    doctorwho:

    image

  9. Notes: 318740 / 3 days ago  from tyleroakley (originally from vinebox)

    susemoji:

    where do these white dads come from

    (Source: vinebox)

  10. Notes: 122503 / 4 days ago  from paul4allseasons (originally from tsabe)
    bishopmyles:

tsabe:

72 Degrees in the shade.
The Animated Self Portrait 
T.S Abe

Amazing…

    bishopmyles:

    tsabe:

    72 Degrees in the shade.

    The Animated Self Portrait 

    T.S Abe

    Amazing…

    (Source: tsabe.co.uk)

     
avatar_128
 
 
 
 

Following

staffdoctorwhocollegehumorpaul4allseasonsburdgeprettycolorsweeradishteamcocostarfleetbabechampionfaustrhettandlinktyleroakleyedwardspoonhandsihnitheclotheshorsebooksofadamhifructosemagjoshiejoshhprettybookszombiephdvelike-nacije-sa-malo-mozgacro-raopsuperdanger-usdanimccreacharliebowateramericastestkitchenjaybendtshawnhuckinsbooksactuallynataliehallseblablastianitsleahelaineunamusedslothelioli-artfishingboatproceedssibyllinesketchblogthebrainscoopalicexzhardtospeakmyheartsevenangelsinstylethought-cafethedsgnblog366sketchbookpugdominationgalaxyspeakingjoeyartcelinechooovi1viseventypercentethanoltvpaletteselasmosaurusbelikedereksiminiblockershardulasophiafosterdiminocourtneygodbeydesignboltemmycchuckgroeninkforeverawandererrcoryloftislulusketchesmintyburpscreaturejournalmegparkivanalifanphilliplighteatyourkimchigifsoitnbmcleankendreeloishthereadablesshoonwhycharlottetrouncewastedtimeboutiquefawnvstephaniepeppersongsthatmeandannystkickthepjjustnerdgirlproblemsedingsfopoppshadeslartmoniatigerlungsrhettandlinkgifsnickallyourbiscuitsacokcteenseatyourkimchistudioathousandtinydoodlessecret-landoxygenanddreamsandellsravenskarfashionblogslucongrandamonium
 

Tumblr